PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G107700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 546aa    MW: 58565.2 Da    PI: 7.2758
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G107700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.98.3e-24167210245
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Seita.9G107700.2.p 167 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 210
                         69***************************************986 PP

2QLQ59.69e-2199135137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+ +L++Q+l+yKyLaan P+P+ Ll++i++
  Seita.9G107700.2.p  99 GPFTPSQWIELEHQALIYKYLAANIPIPHSLLVPIRR 135
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.3E-1299135IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.009100135IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-14100134IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65166210IPR014977WRC domain
PfamPF088794.5E-20168209IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MDITYESVLL IRFLILAAST LFQIFVSFSC LYPALGLCLG NACISVVISM KQYMFLAVPC  60
WLSLLCCSSL TLPACFIPAG LSSVSLSSSM QGAMARVRGP FTPSQWIELE HQALIYKYLA  120
ANIPIPHSLL VPIRRSLASS PYPPSYFGTS TLGWGSFQLG YSGNADLEPG RCRRTDGKKW  180
RCSRDAVADQ KYCERHMNRG RHRSRKHVEG QPGHAAKAMS AAVAAAAATQ PAALAASGAG  240
ATAAGLTVSQ HQQPVKSYAA GATDPCSLQY NRELVNKQNE SDNMQDSDNL SMLTSMSTRN  300
PGSLFPFSKQ NNPFEVTSSR PEFGLVSSDS LMSSPHSSLE NVNLLSSQSL NENQSSASLQ  360
HFVDWPRTPA QGGLSWPDAE DMQAQRSQLS VSAPMASSEL SSASTSPIHE KLMLSPLKLS  420
REYSPIGLSI AASRDEVSQL EANWATMFRD SSMGGPLGEV LTKNGNAEAK NCLSAPLNLL  480
TDFWDSSPGM ESSPVGVLQK TTFGSVSSST GSSPRMENHG AYDGISNLRD DLGSIVVSHP  540
NIRLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0637590.0BT063759.1 Zea mays full-length cDNA clone ZM_BFc0104G18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLK4A7G60.0K4A7G6_SETIT; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-49growth-regulating factor 2